PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G345700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 402aa    MW: 44784.9 Da    PI: 6.7061
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G345700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.1e-16126171147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg W + Ed +l+++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
  Aqcoe1G345700.1.p 126 RGHWRPGEDIKLKELVAQFGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 171
                        899*****************************.***********996 PP

2Myb_DNA-binding52.79.8e-17178221146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        r+++ +eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
  Aqcoe1G345700.1.p 178 RKAFNEEEEERLLAAHRLYGNK-WAMIARLFP-GRTDNAVKNYWHV 221
                        7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.656121172IPR017930Myb domain
SuperFamilySSF466896.36E-27125219IPR009057Homeodomain-like
SMARTSM007174.1E-13125174IPR001005SANT/Myb domain
PfamPF002491.0E-15126171IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-25127179IPR009057Homeodomain-like
CDDcd001673.09E-12129170No hitNo description
PROSITE profilePS5129424.881173227IPR017930Myb domain
SMARTSM007171.1E-14177225IPR001005SANT/Myb domain
PfamPF002492.0E-13178220IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-20180225IPR009057Homeodomain-like
CDDcd001671.60E-7189220No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MSLQHLQDSN ACQTSDDEGC IRRIAGLPFL SPPNGPTHSF LPGSAAGCNK SSKMEIQFLS  60
SPPLELQQKG WNYNQTIDDG NLTNLMFMKQ AGSDEMEEIS ESFIAVNKDH SEVNAGKSSH  120
NKSCSRGHWR PGEDIKLKEL VAQFGPQNWN LIAEKLQGRS GKSCRLRWFN QLDPRINRKA  180
FNEEEEERLL AAHRLYGNKW AMIARLFPGR TDNAVKNYWH VIMARRQREQ SSVYKRRKLS  240
CSSSSSSQPV YNTMEMTTYP NNAQNELTFT SSRDESVSTC TDLSLSSSSA RTNPCLFTNN  300
SPNQHQQLYQ IPIDLSAENM VNGCSQKLDG SGNGFYQLES NMMVMGVNQS GDTPSSYSEV  360
SATDSMVMNM NRKKLTVKSD TESGSDEINV TFIDFLGVGA T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-311262267107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245158.11e-117PREDICTED: myb-related protein 330-like
RefseqXP_010245159.11e-117PREDICTED: myb-related protein 330-like
RefseqXP_010245160.11e-117PREDICTED: myb-related protein 330-like
TrEMBLA0A0B0PES81e-101A0A0B0PES8_G
STRINGPOPTR_0019s05740.11e-96(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.13e-68myb domain protein 105